TSPAN7, Recombinant, Human, aa113-213, His-Tag (Tetraspanin-7)

May be involved in cell proliferation and cell motility. Source: Recombinant protein corresponding to aa113-213 from human TSPAN7, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~15.6kD, AA Sequence: RHEIKDTFLRTYTDAMQTYNGNDERSRAVDHVQRSLSCCGVQNYTNWSTSPYFLEHGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFMETNM, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.