TEP1, Recombinant, Human, aa2-226, His-Tag (Telomerase Protein Component 1)

TEP1, Recombinant, Human, aa2-226, His-Tag (Telomerase Protein Component 1)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
375522.20 20 µg - -

3 - 19 business days*

511.00€
375522.100 100 µg - -

3 - 19 business days*

773.00€
 
Component of the telomerase ribonucleoprotein complex that is essential for the replication of... more
Product information "TEP1, Recombinant, Human, aa2-226, His-Tag (Telomerase Protein Component 1)"
Component of the telomerase ribonucleoprotein complex that is essential for the replication of chromosome termini. Also component of the ribonucleoprotein vaults particle, a multi-subunit structure involved in nucleo-Cytoplasmic domain transport. Responsible for the localizing and stabilizing vault RNA (vRNA) association in the vault ribonucleoprotein particle. Binds to TERC. Source: Recombinant protein corresponding to aa2-226 from human Telomerase Protein Component 1, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~28.9kD, AA Sequence: EKLHGHVSAHPDILSLENRCLAMLPDLQPLEKLHQHVSTHSDILSLKNQCLATLPDLKTMEKPHGYVSAHPDILSLENQCLATLSDLKTMEKPHGHVSAHPDILSLENRCLATLSSLKSTVSASPLFQSLQISHMTQADLYRVNNSNCLLSEPPSWRAQHFSKGLDLSTCPIALKSISATETAQEATLGRWFDSEEKKGAETQMPSYSLSLGEEEEVEDLAVKLT, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Keywords: p240, TLP1, TEP1, Telomerase protein 1, p80 telomerase homolog, Telomerase protein component 1, Telomerase-associated protein 1
Supplier: United States Biological
Supplier-Nr: 375522

Properties

Conjugate: No
Host: E.coli
Species reactivity: human
MW: 28.9 kD
Purity: ?90% (SDS-PAGE)

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "TEP1, Recombinant, Human, aa2-226, His-Tag (Telomerase Protein Component 1)"
Write a review
or to review a product.
Viewed