StxB2, Recombinant, Enterobacteria phage 933W, aa20-89, His-Tag (Shiga-like Toxin 2 Subunit B)

The B subunit is responsible for the binding of the holotoxin to specific receptors on the target cell surface, such as globotriaosylceramide (Gb3) in human intestinal microvilli. Source: Recombinant protein corresponding to aa20-89 from enterobacteria phage 933W, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~9.8kD, AA Sequence: ADCAKGKIEFSKYNEDDTFTVKVDGKEYWTSRWNLQPLLQSAQLTGMTVTIKSSTCESGSGFAEVQFNND, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.