SMT3, Recombinant, S. cerevisiae, aa2-98, His-Tag (Ubiquitin-like Protein SMT3)

Not known, suppressor of MIF2 mutations. Source: Recombinant protein corresponding to aa2-98 from saccharomyces cerevisiae SMT3, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~13.1kD, AA Sequence: SDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGG, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.