Scrg1, Recombinant, Mouse, aa21-98, His-Tag (Scrapie-responsive Protein 1)

Source:, Recombinant protein corresponding to aa21-98 from mouse Scrg1, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~11.0kD, AA Sequence: MPSSRLSCYRKLLKDRNCHNLPEGRADLKLIDANVQHHFWDGKGCEMICYCNFSELLCCPKDVFFGPKISFVIPCNNH, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.