Sarcoplasmic Calcium Binding Protein, Recombinant, Penaeus Monodon, aa1-193, His-SUMO-Tag

Source:, Recombinant protein corresponding to aa1-193 from penaeus monodon Sarcoplasmic calcium binding protein, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~38.1kD, AA Sequence: MAYSWDNRVKYVVRYMYDIDNNGFLDKNDFECLAVRNTLIEGRGEFSADAYANNQKIMRNLWNEIAELADFNKDGEVTVDEFKQAVQKHCQGKKYGDFPGAFKVFIANQFKAIDVNGDGKVGLDEYRLDCITRSAFAEVKEIDDAYNKLTTEDDRKAGGLTLERYQDLYAQFISNPDESCSACYLFGPLKVVQ, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.