SacIM, Recombinant, Streptomyces Achromogenes, aa1-390, His-SUMO-Tag (Modification Methylase SacI)

This methylase recognizes the double-stranded sequence GAGCTC, causes specific methylation on C-4 on both strands, and protects the DNA from cleavage by the SacI endonuclease. Source: Recombinant protein corresponding to aa1-390 from streptomyces achromogenes saclM, fused to His-SUMO-Tag at N-terminal expressed in E. coli. Molecular Weight: ~59.3kD, AA Sequence: MNHELPVISLFSGAGGLDCAIESCAEPPLVQDGSGSPLRVAVATDYEQTALDTLSANFPHTKTLCGDIQTIPTAELLEAGGLKPGDPTLVIGGPPCTPFSKSGFWIEEKRNSADPNASLLDEYVRVVRESKPEAFILENVQGLTYKTHQAQFDRLIAGLKDAGYNPTFRVLLAAEYGVPQLRRRVFVVGRRDGKAFHFPETTHSGESERDRVIDHTKIPFTSLREALAGLPDVPEAGEVVEGTYAELAAEVPPGQNYLWHTDRYGGRNEFKWRSRYWTFLLKADPDRPSTTLQAQPGPWVGPFHWENVKNANGEERARRFRVAEMKRIMTFPDEFVFTGVKREVQRQIGNPVPVELGKVVVRALMEQLGYLDSRGTTIPSQAGHEQLELI, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.