S-arrestin, Recombinant, Human, aa1-405, His-Tag (SAG)

S-arrestin, Recombinant, Human, aa1-405, His-Tag (SAG)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
370788.20 20 µg - -

3 - 19 business days*

621.00€
370788.100 100 µg - -

3 - 19 business days*

947.00€
 
Arrestin is one of the major proteins of the ros (retinal rod outer segments), it binds to... more
Product information "S-arrestin, Recombinant, Human, aa1-405, His-Tag (SAG)"
Arrestin is one of the major proteins of the ros (retinal rod outer segments), it binds to photoactivated-phosphorylated rhodopsin, thereby apparently preventing the transducin-mediated activation of phosphodiesterase. Source: Recombinant protein corresponding to aa1-405 from human SAG, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~47.1kD, AA Sequence: MAASGKTSKSEPNHVIFKKISRDKSVTIYLGNRDYIDHVSQVQPVDGVVLVDPDLVKGKKVYVTLTCAFRYGQEDIDVIGLTFRRDLYFSRVQVYPPVGAASTPTKLQESLLKKLGSNTYPFLLTFPDYLPCSVMLQPAPQDSGKSCGVDFEVKAFATDSTDAEEDKIPKKSSVRLLIRKVQHAPLEMGPQPRAEAAWQFFMSDKPLHLAVSLNKEIYFHGEPIPVTVTVTNNTEKTVKKIKAFVEQVANVVLYSSDYYVKPVAMEEAQEKVPPNSTLTKTLTLLPLLANNRERRGIALDGKIKHEDTNLASSTIIKEGIDRTVLGILVSYQIKVKLTVSGFLGELTSSEVATEVPFRLMHPQPEDPAKESYQDANLVFEEFARHNLKDAGEAEEGKRDKNDVDE, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Keywords: SAG, S-AG, S-arrestin, 48 kDa protein, Retinal S-antigen, Rod photoreceptor arrestin
Supplier: United States Biological
Supplier-Nr: 370788

Properties

Conjugate: No
MW: 47,1
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "S-arrestin, Recombinant, Human, aa1-405, His-Tag (SAG)"
Write a review
or to review a product.
Viewed