RpsF, Recombinant, E. coli, aa1-131, GST-Tag (30S Ribosomal Protein S6)

RpsF, Recombinant, E. coli, aa1-131, GST-Tag (30S Ribosomal Protein S6)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
375149.20 20 µg - -

3 - 19 business days*

636.00€
375149.100 100 µg - -

3 - 19 business days*

985.00€
 
Binds together with S18 to 16S ribosomal RNA.||Source:|Recombinant protein corresponding to... more
Product information "RpsF, Recombinant, E. coli, aa1-131, GST-Tag (30S Ribosomal Protein S6)"
Binds together with S18 to 16S ribosomal RNA. Source: Recombinant protein corresponding to aa1-131 from E. coli rpsF, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~42.2kD, AA Sequence: MRHYEIVFMVHPDQSEQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEVIDELETTFRFNDAVIRSMVMRTKHAVTEASPMVKAKDERRERRDDFANETADDAEAGDSEE, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Keywords: rpsF, b4200
Supplier: United States Biological
Supplier-Nr: 375149

Properties

Conjugate: No
MW: 42,2
Format: Highly Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "RpsF, Recombinant, E. coli, aa1-131, GST-Tag (30S Ribosomal Protein S6)"
Write a review
or to review a product.
Viewed