RpmA, Recombinant, E. coli, aa2-85, GST-Tag (50S Ribosomal Protein L27)

RpmA, Recombinant, E. coli, aa2-85, GST-Tag (50S Ribosomal Protein L27)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
375116.20 20 µg - -

3 - 19 business days*

636.00€
375116.100 100 µg - -

3 - 19 business days*

985.00€
 
Source:|Recombinant protein corresponding to aa2-85 from E. coli 50S Ribosomal Protein L27, fused... more
Product information "RpmA, Recombinant, E. coli, aa2-85, GST-Tag (50S Ribosomal Protein L27)"
Source:, Recombinant protein corresponding to aa2-85 from E. coli 50S Ribosomal Protein L27, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~36.0kD, AA Sequence: AHKKAGGSTRNGRDSEAKRLGVKRFGGESVLAGSIIVRQRGTKFHAGANVGCGRDHTLFAKADGKVKFEVKGPKNRKFISIEAE, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Keywords: rpmA, b3185, 50S ribosomal protein L27, Large ribosomal subunit protein bL27
Supplier: United States Biological
Supplier-Nr: 375116

Properties

Conjugate: No
MW: 36
Format: Highly Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "RpmA, Recombinant, E. coli, aa2-85, GST-Tag (50S Ribosomal Protein L27)"
Write a review
or to review a product.
Viewed