ROR1, Recombinant, Human, aa30-391, His-Tag (Tyrosine-protein Kinase Transmembrane Receptor ROR1)

ROR1, Recombinant, Human, aa30-391, His-Tag (Tyrosine-protein Kinase Transmembrane Receptor ROR1)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
375083.20 20 µg - -

3 - 19 business days*

531.00€
375083.100 100 µg - -

3 - 19 business days*

773.00€
 
Tyrosine-protein kinase receptor whose role is not yet clear.||Source:|Recombinant protein... more
Product information "ROR1, Recombinant, Human, aa30-391, His-Tag (Tyrosine-protein Kinase Transmembrane Receptor ROR1)"
Tyrosine-protein kinase receptor whose role is not yet clear. Source: Recombinant protein corresponding to aa30-391 from human ROR1, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~42.5kD, AA Sequence: QETELSVSAELVPTSSWNISSELNKDSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVATNGKEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPAC, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Keywords: ROR1, NTRKR1, Neurotrophic tyrosine kinase, receptor-related 1, Inactive tyrosine-protein kinase transmembrane receptor ROR1
Supplier: United States Biological
Supplier-Nr: 375083

Properties

Conjugate: No
MW: 42,5
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "ROR1, Recombinant, Human, aa30-391, His-Tag (Tyrosine-protein Kinase Transmembrane Receptor ROR1)"
Write a review
or to review a product.
Viewed