QPCTL, Recombinant, Human, aa212-382, His-SUMO-Tag (Glutaminyl-peptide Cyclotransferase-like Protein

Responsible for the biosynthesis of pyroglutamyl peptides. Source: Recombinant protein corresponding to aa212-382 from human QPCTL, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~35.5kD, AA Sequence: AAPVTLQLLFLDGEEALKEWGPKDSLYGSRHLAQLMESIPHSPGPTRIQAIELFMLLDLLGAPNPTFYSHFPRTVRWFHRLRSIEKRLHRLNLLQSHPQEVMYFQPGEPFGSVEDDHIPFLRRGVPVLHLISTPFPAVWHTPADTEVNLHPPTVHNLCRILAVFLAEYLGL, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.