PSMB2, Recombinant, Human, aa1-201, GST-Tag (Proteasome Subunit beta Type-2)

PSMB2, Recombinant, Human, aa1-201, GST-Tag (Proteasome Subunit beta Type-2)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
374908.20 20 µg - -

3 - 19 business days*

511.00€
374908.100 100 µg - -

3 - 19 business days*

773.00€
 
The proteasome is a multicatalytic proteinase complex which is characterized by its ability to... more
Product information "PSMB2, Recombinant, Human, aa1-201, GST-Tag (Proteasome Subunit beta Type-2)"
The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. This subunit has a trypsin-like activity. Source: Recombinant protein corresponding to aa1-201 from human PSMB2, fused to GST-Tag at N-terminal expressed in E. coli. Molecular Weight: ~49.8kD, AA Sequence: MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDLDNISFPKQGS, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Keywords: PSMB2, Macropain subunit C7-I, Proteasome component C7-I, Proteasome subunit beta type-2, Multicatalytic endopeptidase complex subunit C7-I
Supplier: United States Biological
Supplier-Nr: 374908

Properties

Conjugate: No
MW: 49,8
Format: Highly Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "PSMB2, Recombinant, Human, aa1-201, GST-Tag (Proteasome Subunit beta Type-2)"
Write a review
or to review a product.
Viewed