PRIM1, Recombinant, Human, aa1-420, His-SUMO-Tag (DNA Primase Small Subunit)

PRIM1, Recombinant, Human, aa1-420, His-SUMO-Tag (DNA Primase Small Subunit)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
374848.20 20 µg - -

3 - 19 business days*

511.00€
374848.100 100 µg - -

3 - 19 business days*

773.00€
 
DNA primase is the polymerase that synthesizes small RNA primers for the Okazaki fragments made... more
Product information "PRIM1, Recombinant, Human, aa1-420, His-SUMO-Tag (DNA Primase Small Subunit)"
DNA primase is the polymerase that synthesizes small RNA primers for the Okazaki fragments made during discontinuous DNA replication. Source: Recombinant protein corresponding to aa1-420 from human PRIM1, fused to His-SUMO-Tag at N-terminal expressed in E. coli. Molecular Weight: ~65.9kD, AA Sequence: METFDPTELPELLKLYYRRLFPYSQYYRWLNYGGVIKNYFQHREFSFTLKDDIYIRYQSFNNQSDLEKEMQKMNPYKIDIGAVYSHRPNQHNTVKLGAFQAQEKELVFDIDMTDYDDVRRCCSSADICPKCWTLMTMAIRIIDRALKEDFGFKHRLWVYSGRRGVHCWVCDESVRKLSSAVRSGIVEYLSLVKGGQDVKKKVHLSEKIHPFIRKSINIIKKYFEEYALVNQDILENKESWDKILALVPETIHDELQQSFQKSHNSLQRWEHLKKVASRYQNNIKNDKYGPWLEWEIMLQYCFPRLDINVSKGINHLLKSPFSVHPKTGRISVPIDLQKVDQFDPFTVPTISFICRELDAISTNEEEKEENEAESDVKHRTRDYKKTSLAPYVKVFEHFLENLDKSRKGELLKKSDLQKDF, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Keywords: p49, PRIM1, EC=2.7.7.-, DNA primase small subunit, DNA primase 49 kDa subunit
Supplier: United States Biological
Supplier-Nr: 374848

Properties

Conjugate: No
MW: 65,9
Format: Highly Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "PRIM1, Recombinant, Human, aa1-420, His-SUMO-Tag (DNA Primase Small Subunit)"
Write a review
or to review a product.
Viewed