PPX1, Recombinant, Saccharomyces Cerevisiae, aa1-397, His-Tag (Exopolyphosphatase)

PPX1, Recombinant, Saccharomyces Cerevisiae, aa1-397, His-Tag (Exopolyphosphatase)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
374830.20 20 µg - -

3 - 19 business days*

636.00€
374830.100 100 µg - -

3 - 19 business days*

985.00€
 
Degradation of inorganic polyphosphates.||Source:|Recombinant protein corresponding to aa1-397... more
Product information "PPX1, Recombinant, Saccharomyces Cerevisiae, aa1-397, His-Tag (Exopolyphosphatase)"
Degradation of inorganic polyphosphates. Source: Recombinant protein corresponding to aa1-397 from saccharomyces cerevisiae PPX1, fused to His-Tag at N-terminal expressed in E. coli. Molecular Weight: ~49.1kD, AA Sequence: MSPLRKTVPEFLAHLKSLPISKIASNDVLTICVGNESADMDSIASAITYSYCQYIYNEGTYSEEKKKGSFIVPIIDIPREDLSLRRDVMYVLEKLKIKEEELFFIEDLKSLKQNVSQGTELNSYLVDNNDTPKNLKNYIDNVVGIIDHHFDLQKHLDAEPRIVKVSGSCSSLVFNYWYEKLQGDREVVMNIAPLLMGAILIDTSNMRRKVEESDKLAIERCQAVLSGAVNEVSAQGLEDSSEFYKEIKSRKNDIKGFSVSDILKKDYKQFNFQGKGHKGLEIGLSSIVKRMSWLFNEHGGEADFVNQCRRFQAERGLDVLVLLTSWRKAGDSHRELVILGDSNVVRELIERVSDKLQLQLFGGNLDGGVAMFKQLNVEATRKQVVPYLEEAYSNLEE, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Keywords: PPX1, YHR201C, EC=3.6.1.11, ExopolyPase, Metaphosphatase, Exopolyphosphatase
Supplier: United States Biological
Supplier-Nr: 374830

Properties

Conjugate: No
MW: 49,1
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "PPX1, Recombinant, Saccharomyces Cerevisiae, aa1-397, His-Tag (Exopolyphosphatase)"
Write a review
or to review a product.
Viewed