PolC, Recombinant, Cenarchaeum Symbiosum, aa287-832 (DNA Polymerase II Large Subunit)

PolC, Recombinant, Cenarchaeum Symbiosum, aa287-832 (DNA Polymerase II Large Subunit)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
374787.20 20 µg - -

3 - 19 business days*

623.00€
374787.100 100 µg - -

3 - 19 business days*

909.00€
 
Possesses two activities: a DNA synthesis (polymerase) and an exonucleolytic activity that... more
Product information "PolC, Recombinant, Cenarchaeum Symbiosum, aa287-832 (DNA Polymerase II Large Subunit)"
Possesses two activities: a DNA synthesis (polymerase) and an exonucleolytic activity that degrades single-stranded DNA in the 3'- to 5'-direction. Has a template-primer preference which is characteristic of a replicative DNA polymerase. Source: Recombinant protein corresponding to aa287-832 from cenarchaeum symbiosum polC, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~59.0kD, AA Sequence: LAELKGAVQTGENKEDAAAKRMREVITGRSVLSMPNRLGGFRLRYGRACNTGYTSVGFHPAVAEILDHTIAVGTQVKIDIPGKGATVAFVDTIEAPTVRLAGGDVVKIRDVAHGIELKGSIERILHLGDMLISFGDFLENNAQLVPSGYVEEIWKMDMEAAGAAQGSPSSADEAVRISRELGVPLHPRYLYYWDQISHEELAMLLSPLDKGDAISYPAACKPVLEKLGVPHKAGPEGPVLEGDEARIFRELILDNPPGPDASAPVPELISRSSGITIRDKFSTSIGVRIGRPEKAAPRQMRPPTHCLFPVGGTGGPTNNLLKSAARPGFSADILSRRCPGCGEPSISIRCWACGERTAVERTCMQCGTDVDGEECERCGRPGLAHSRVEFPLKKMLVSAQEKTGVRAHDPLKGVKELAHQDRIAEPLEKGLIRQSRSLTVFKDGTVRFDATNSPMTHFKPSWIGTSAEKLRELGYETDVDGKKLEGPDQLVELRMQDIVIPLEGAKYLVSACGYIDAELDKLYGAPPFYKVPDLGGLIGHLVVGLA, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Keywords: Pol II, CENSYa_1827, DNA polymerase II large subunit, Exodeoxyribonuclease large subunit
Supplier: United States Biological
Supplier-Nr: 374787

Properties

Conjugate: No
MW: 59
Format: Purified

Database Information

KEGG ID : K02322 | Matching products
UniProt ID : A0RYM0 | Matching products

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "PolC, Recombinant, Cenarchaeum Symbiosum, aa287-832 (DNA Polymerase II Large Subunit)"
Write a review
or to review a product.
Viewed