Pmp20, Recombinant, Neosartorya Fumigata, aa1-168, His-SUMO-Tag (Putative Peroxiredoxin Pmp20)

Source:, Recombinant protein corresponding to aa1-168 from neosartorya fumigata pmp20, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~34.5kD, AA Sequence: MSGLKAGDSFPSDVVFSYIPWSEDKGEITACGIPINYNASKEWADKKVILFALPGAFTPVCSARHVPEYIEKLPEIRAKGVDVVAVLAYNDAYVMSAWGKANQVTGDDILFLSDPDARFSKSIGWADEEGRTKRYALVIDHGKITYAALEPAKNHLEFSSAETVLKHL, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.