Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
---|---|---|---|---|---|---|---|
298447.100 | 100 µg | - | - |
3 - 19 business days* |
916.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
PHIP is a bromodomain-containing protein that binds the pleckstrin homology (PH) domain of... more
Product information "PHIP (BD1), Recombinant, Human, aa1146-1287, His-Tag (Bromodomain Pleckstrin Homology Domain Interac"
PHIP is a bromodomain-containing protein that binds the pleckstrin homology (PH) domain of insulin receptor substrate-1 (IRS1), modulates insulin signaling, and plays a role in pancreatic beta cell growth and survival. It stimulates cell proliferation through regulation of cyclin transcription and has an anti-apoptotic activity through AKT1 phosphorylation and activation. Source: Recombinant protein corresponding to bromodomain 1, aa1146-1287, from human PHIP, fused to His-tag at N-terminal, expressed in E. coli. Molecular Weight: ~17kD, AA Sequence: MHHHHHHSLIYKPLDGEWGTNPRDEECERIVAGINQLMTLDIASAFVAPVDLQAYPMY, CTVVAYPTDLSTIKQRLENRFYRRVSSLMWEVRYIEHNTRTFNEPGSPIVKSAKFVTDL, LLHFIKDQTCYNIIPLYNSMKKKVLSDSEDEE, Applications: Suitable for use in the study of bromodomain binding assays, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Keywords: | PHIP, DCAF14, PH-interacting protein, IRS-1 PH domain-binding protein, WD repeat-containing protein 11, DDB1- and CUL4-associated factor 14 |
Supplier: | United States Biological |
Supplier-Nr: | 298447 |
Properties
Conjugate: | No |
Host: | E.coli |
Species reactivity: | human |
MW: | 17 kD |
Purity: | ~90% |
Format: | Purified |
Database Information
KEGG ID : | K11797 | Matching products |
UniProt ID : | Q8WWQ0 | Matching products |
Gene ID | GeneID 55023 | Matching products |
Handling & Safety
Storage: | -80°C |
Shipping: | -20°C (International: °C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed