PHIP (BD1), Recombinant, Human, aa1146-1287, GST-tag (Bromodomain Pleckstrin Homology Domain Interac

PHIP (BD1), Recombinant, Human, aa1146-1287, GST-tag (Bromodomain Pleckstrin Homology Domain Interac
Item number Size Datasheet Manual SDS Delivery time Quantity Price
298446.100 100 µg - -

3 - 19 business days*

916.00€
 
PHIP is a bromodomain-containing protein that binds the pleckstrin homology (PH) domain of... more
Product information "PHIP (BD1), Recombinant, Human, aa1146-1287, GST-tag (Bromodomain Pleckstrin Homology Domain Interac"
PHIP is a bromodomain-containing protein that binds the pleckstrin homology (PH) domain of insulin receptor substrate-1 (IRS1), modulates insulin signaling, and plays a role in pancreatic beta cell growth and survival. It stimulates cell proliferation through regulation of cyclin transcription and has an anti-apoptotic activity through AKT1 phosphorylation and activation. Source: Recombinant protein corresponding to bromodomain 1, aa1146-1287, from human PHIP, fused to GST-tag at N-terminal, expressed in E. coli. Molecular Weight: ~43kD, AA Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYI, DGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLK, VDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLV, CFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSSLIYK, PLDGEWGTNPRDEECERIVAGINQLMTLDIASAFVAPVDLQAYPMYCTVVAYPTDLST, IKQRLENRFYRRVSSLMWEVRYIEHNTRTFNEPGSPIVKSAKFVTDLLLHFIKDQTCYNI, IPLYNSMKKKVLSDSEDEE, Applications: Suitable for use in the study of bromodomain binding assays, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Keywords: PHIP, DCAF14, PH-interacting protein, IRS-1 PH domain-binding protein, WD repeat-containing protein 11, DDB1- and CUL4-associated factor 14
Supplier: United States Biological
Supplier-Nr: 298446

Properties

Conjugate: No
Host: E.coli
Species reactivity: human
MW: 43 kD
Purity: ~71%
Format: Purified

Handling & Safety

Storage: -80°C
Shipping: -20°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "PHIP (BD1), Recombinant, Human, aa1146-1287, GST-tag (Bromodomain Pleckstrin Homology Domain Interac"
Write a review
or to review a product.
Viewed