NME4, Recombinant, Human, aa1-187, GST-Tag (Nucleoside Diphosphate Kinase, Mitochondrial)

NME4, Recombinant, Human, aa1-187, GST-Tag (Nucleoside Diphosphate Kinase, Mitochondrial)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
374431.20 20 µg - -

3 - 19 business days*

511.00€
374431.100 100 µg - -

3 - 19 business days*

773.00€
 
Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate... more
Product information "NME4, Recombinant, Human, aa1-187, GST-Tag (Nucleoside Diphosphate Kinase, Mitochondrial)"
Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Through the catalyzed exchange of gamma-phosphate between di- and triphosphonucleosides participates in regulation of intracellular nucleotide homeostasis. Binds to anionic phospholipids, predominantly to cardiolipin, the binding inhibits its phosphotransfer activity. Acts as mitochondria-specific NDK, its association with cardiolipin-containing mitochondrial inner membrane is coupled to respiration suggesting that ADP locally regenerated in the mitochondrion innermembrane space by its activity is directly taken up via ANT ADP/ATP translocase into the matrix space to stimulate respiratory ATP regeneration. Proposed to increase GTP-loading on dynamin-related GTPase OPA1 in mitochondria. In vitro can induce liposome cross-linking suggesting that it can cross-link inner and outer membranes to form contact sites, and promotes intermembrane migration of anionic phosphoplipids. Promotes the redistribution of cardiolipin between the mitochondrial inner membrane and outer membrane which is implicated in pro-apoptotic signaling. Source: Recombinant protein corresponding to aa1-187 from human NME4, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~44.3kD, AA Sequence: SWTRERTLVAVKPDGVQRRLVGDVIQRFERRGFTLVGMKMLQAPESVLAEHYQDLRRKPFYPALIRYMSSGPVVAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSVEGAQREIQLWFQSSELVSWADGGQHSSIHPA, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Keywords: NDK, NME4, NM23D, NDPKD, nm23-H4, EC=2.7.4.6, NDP kinase, mitochondrial, Nucleoside diphosphate kinase D, Nucleoside diphosphate kinase, mitochondrial
Supplier: United States Biological
Supplier-Nr: 374431

Properties

Conjugate: No
MW: 44,3
Format: Highly Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "NME4, Recombinant, Human, aa1-187, GST-Tag (Nucleoside Diphosphate Kinase, Mitochondrial)"
Write a review
or to review a product.
Viewed