Nicotinamidase, Recombinant, Saccharomyces Cerevisiae, aa1-216 (PNC1)

Nicotinamidase, Recombinant, Saccharomyces Cerevisiae, aa1-216 (PNC1)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
406003.20 20 µg - -

3 - 19 business days*

684.00€
406003.100 100 µg - -

3 - 19 business days*

1,019.00€
 
Catalyzes the deamidation of nicotinamide, an early step in the NAD+ salvage pathway. Positively... more
Product information "Nicotinamidase, Recombinant, Saccharomyces Cerevisiae, aa1-216 (PNC1)"
Catalyzes the deamidation of nicotinamide, an early step in the NAD+ salvage pathway. Positively regulates SIR2-mediated silencing and longevity by preventing the accumulation of intracellular nicotinamide, an inhibitor of SIR2, during times of stress. Acts also on nicotinyl hydroxamate. Source: Recombinant protein corresponding to aa1-216 from Saccharomyces cerevisiae Nicotinamidase, expressed in E. coli. Molecular Weight: ~25kD, AA Sequence: MKTLIVVDMQNDFISPLGSLTVPKGEELINPISDLMQDADRDWHRIVVTRDWHPSRHISFAKNHKDKEPYSTYTYHSPRPGDDSTQEGILWPVHCVKNTWGSQLVDQIMDQVVTKHIKIVDKGFLTDREYYSAFHDIWNFHKTDMNKYLEKHHTDEVYIVGVALEYCVKATAISAAELGYKTTVLLDYTRPISDDPEVINKVKEELKAHNINVVDK, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Keywords: PNC1, NAMase, YGL037C, Nicotinamidase, Nicotinamide deamidase
Supplier: United States Biological
Supplier-Nr: 406003

Properties

Conjugate: No
MW: 25
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Nicotinamidase, Recombinant, Saccharomyces Cerevisiae, aa1-216 (PNC1)"
Write a review
or to review a product.
Viewed