MYLPF, Recombinant, Human, aa2-169, His-SUMO-Tag (Myosin Regulatory Light Chain 2, Skeletal Muscle I

Source:, Recombinant protein corresponding to aa2-169 from human MYLPF, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~34.9kD, AA Sequence: APKRAKRRTVEGGSSSVFSMFDQTQIQEFKEAFTVIDQNRDGIIDKEDLRDTFAAMGRLNVKNEELDAMMKEASGPINFTVFLTMFGEKLKGADPEDVITGAFKVLDPEGKGTIKKKFLEELLTTQCDRFSQEEIKNMWAAFPPDVGGNVDYKNICYVITHGDAKDQE, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.