MS4A1, Recombinant, Mouse, aa132-291, His-Tag (B-lymphocyte Antigen CD20)

This protein may be involved in the regulation of B-cell activation and proliferation. Source: Recombinant protein corresponding to aa132-291 from mouse MS4A1, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~20.1kD, AA Sequence: ILNMTLSHFLKMRRLELIQTSKPYVDIYDCEPSNSSEKNSPSTQYCNSIQSVFLGILSAMLISAFFQKLVTAGIVENEWKRMCTRSKSNVVLLSAGEKNEQTIKMKEEIIELSGVSSQPKNEEEIEIIPVQEEEEEEAEINFPAPPQEQESLPVENEIAP, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.