Ms4a1, Recombinant, Mouse aa132-291, His-SUMO-Tag, (B-lymphocyte Antigen CD20)

This protein may be involved in the regulation of B-cell activation and proliferation. Source: Recombinant protein corresponding to aa132-291 from mouse Ms4a1, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~34.1kD, AA Sequence: ILNMTLSHFLKMRRLELIQTSKPYVDIYDCEPSNSSEKNSPSTQYCNSIQSVFLGILSAMLISAFFQKLVTAGIVENEWKRMCTRSKSNVVLLSAGEKNEQTIKMKEEIIELSGVSSQPKNEEEIEIIPVQEEEEEEAEINFPAPPQEQESLPVENEIAP, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.