Lymphocyte Antigen 6 Complex Locus Protein G6d, Recombinant, Human, aa10-104, His-B2M-JD-tag (LY6G6D

Source:, Recombinant protein corresponding to aa10-104 from human lymphocyte Antigen 6 complex locus protein G6d, fused to His-B2M-JD-tag at N-terminal, expressed in E. coli. Molecular Weight: ~15.5kD, AA Sequence: LSSLLGAALGNRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNS, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.