Ly6e, Recombinant, Mouse, aa21-102, His-SUMO-Tag (Lymphocyte Antigen 6E)

Ly6e, Recombinant, Mouse, aa21-102, His-SUMO-Tag (Lymphocyte Antigen 6E)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
374097.20 20 µg - -

3 - 19 business days*

497.00€
374097.100 100 µg - -

3 - 19 business days*

777.00€
 
Involved in T-cell development.||Source:|Recombinant protein corresponding to aa21-102 from mouse... more
Product information "Ly6e, Recombinant, Mouse, aa21-102, His-SUMO-Tag (Lymphocyte Antigen 6E)"
Involved in T-cell development. Source: Recombinant protein corresponding to aa21-102 from mouse Lymphocyte Antigen 6E, fused to His-SUMO-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~24.8kD, AA Sequence: LMCFSCTDQKNNINCLWPVSCQEKDHYCITLSAAAGFGNVNLGYTLNKGCSPICPSENVNLNLGVASVNSYCCQSSFCNFSA, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Keywords: Ly67, Ly6e, TSA-1, Ly-6E, Stem cell antigen 2, Lymphocyte antigen 6E, Thymic shared antigen 1
Supplier: United States Biological
Supplier-Nr: 374097

Properties

Conjugate: No
MW: 24,8
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Ly6e, Recombinant, Mouse, aa21-102, His-SUMO-Tag (Lymphocyte Antigen 6E)"
Write a review
or to review a product.
Viewed