LUC7L3, Recombinant, Human, aa1-79, His-Tag (Luc7-like Protein 3)

Binds cAMP regulatory element DNA sequence. May play a role in RNA splicing. Source: Recombinant protein corresponding to aa1-79 from human LUC7L3, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~13.3kD, AA Sequence: MISAAQLLDELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLGPCEKIHDENLRKQYEKSSRFMKV, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.