Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
---|---|---|---|---|---|---|---|
298422.100 | 100 µg | - | - |
3 - 19 business days* |
1,151.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
Polycomb group (PcG) protein that specifically recognizes and binds mono- and dimethyl-lysine... more
Product information "L3MBTL1, Recombinant, Human, aa191-530, His-Tag (Lethal(3) Malignant Brain Tumor-Like Protein 1)"
Polycomb group (PcG) protein that specifically recognizes and binds mono- and dimethyl-lysine residues on target proteins, therey acting as a reader of a network of post-translational modifications. PcG proteins maintain the transcriptionally repressive state of genes: acts as a chromatin compaction factor by recognizing and binding mono- and dimethylated histone H1b/HIST1H1E at Lys26 (H1bK26me1 and H1bK26me2) and histone H4 at Lys-20 (H4K20me1 and H4K20me2), leading to condense chromatin and repress transcription. Recognizes and binds p53/TP53 monomethylated at Lys-382, leading to repress p53/TP53-target genes. Also recognizes and binds RB1/RB monomethylated at Lys-860. Participates in the ETV6-mediated repression. Probably plays a role in cell proliferation. Overexpression induces multinucleated cells, suggesting that it is required to accomplish normal mitosis. Source: Recombinant protein corresponding to aa191-530 from human L3MBTL1, fused to His-tag at N-terminal, expressed in E. coli. Molecular Weight: ~39.6kD, AA Sequence: MHHHHHHEWSSSQPATGEKKECWSWESYLEEQKAITAPVSLFQDSQAVTHNKNGF, KLGMKLEGIDPQHPSMYFILTVAEVCGYRLRLHFDGYSECHDFWVNANSPDIHPAGW, FEKTGHKLQPPKGYKEEEFSWSQYLRSTRAQAAPKHLFVSQSHSPPPLGFQVGMKL, EAVDRMNPSLVCVASVTDVVDSRFLVHFDNWDDTYDYWCDPSSPYIHPVGWCQKQG, KPLTPPQDYPDPDNFCWEKYLEETGASAVPTWAFKVRPPHSFLVNMKLEAVDRRNP, ALIRVASVEDVEDHRIKIHFDGWSHGYDFWIDADHPDIHPAGWCSKTGHPLQPPLGPR, EPSSASPGG, Applications: Suitable for use in the study of Polycomb group (PcG) proteins, protein binding assays, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Keywords: | L3MBTL1, KIAA0681, H-l(3)mbt, L(3)mbt-like, H-l(3)mbt protein, L(3)mbt protein homolog, Lethal(3)malignant brain tumor-like protein 1 |
Supplier: | United States Biological |
Supplier-Nr: | 298422 |
Properties
Conjugate: | No |
MW: | 39,6 |
Format: | Highly Purified |
Database Information
UniProt ID : | Q9Y468 | Matching products |
Gene ID | GeneID 26013 | Matching products |
Handling & Safety
Storage: | -80°C |
Shipping: | -80°C (International: °C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed