L3MBTL1, Recombinant, Human, aa191-530, GST-tag (Lethal(3) Malignant Brain Tumor-Like Protein 1)

L3MBTL1, Recombinant, Human, aa191-530, GST-tag (Lethal(3) Malignant Brain Tumor-Like Protein 1)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
298421.100 100 µg - -

3 - 19 business days*

1,151.00€
 
Polycomb group (PcG) protein that specifically recognizes and binds mono- and dimethyl-lysine... more
Product information "L3MBTL1, Recombinant, Human, aa191-530, GST-tag (Lethal(3) Malignant Brain Tumor-Like Protein 1)"
Polycomb group (PcG) protein that specifically recognizes and binds mono- and dimethyl-lysine residues on target proteins, therey acting as a reader of a network of post-translational modifications. PcG proteins maintain the transcriptionally repressive state of genes: acts as a chromatin compaction factor by recognizing and binding mono- and dimethylated histone H1b/HIST1H1E at Lys26 (H1bK26me1 and H1bK26me2) and histone H4 at Lys-20 (H4K20me1 and H4K20me2), leading to condense chromatin and repress transcription. Recognizes and binds p53/TP53 monomethylated at Lys-382, leading to repress p53/TP53-target genes. Also recognizes and binds RB1/RB monomethylated at Lys-860. Participates in the ETV6-mediated repression. Probably plays a role in cell proliferation. Overexpression induces multinucleated cells, suggesting that it is required to accomplish normal mitosis. Source: Recombinant protein corresponding to aa191-530 from human L3MBTL1, fused to GST-tag at N-terminal, expressed in E. coli. Molecular Weight: ~65.5kD, AA Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYI, DGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLK, VDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLV, CFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSEWSS, SQPATGEKKECWSWESYLEEQKAITAPVSLFQDSQAVTHNKNGFKLGMKLEGIDPQ, HPSMYFILTVAEVCGYRLRLHFDGYSECHDFWVNANSPDIHPAGWFEKTGHKLQPPK, GYKEEEFSWSQYLRSTRAQAAPKHLFVSQSHSPPPLGFQVGMKLEAVDRMNPSLVC, VASVTDVVDSRFLVHFDNWDDTYDYWCDPSSPYIHPVGWCQKQGKPLTPPQDYPDP, DNFCWEKYLEETGASAVPTWAFKVRPPHSFLVNMKLEAVDRRNPALIRVASVEDVED, HRIKIHFDGWSHGYDFWIDADHPDIHPAGWCSKTGHPLQPPLGPREPSSASPGG, Applications: Suitable for use in the study of Polycomb group (PcG) proteins, protein binding assays, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Keywords: L3MBTL1, KIAA0681, H-l(3)mbt, L(3)mbt-like, H-l(3)mbt protein, L(3)mbt protein homolog, Lethal(3)malignant brain tumor-like protein 1
Supplier: United States Biological
Supplier-Nr: 298421

Properties

Conjugate: No
MW: 65,5
Format: Purified

Database Information

UniProt ID : Q9Y468 | Matching products
Gene ID GeneID 26013 | Matching products

Handling & Safety

Storage: -80°C
Shipping: -80°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "L3MBTL1, Recombinant, Human, aa191-530, GST-tag (Lethal(3) Malignant Brain Tumor-Like Protein 1)"
Write a review
or to review a product.
Viewed