KCND1, Recombinant, Human, aa410-647, His-Tag (Potassium Voltage-gated Channel Subfamily D Member 1

KCND1, Recombinant, Human, aa410-647, His-Tag (Potassium Voltage-gated Channel Subfamily D Member 1
Item number Size Datasheet Manual SDS Delivery time Quantity Price
373900.20 20 µg - -

3 - 19 business days*

511.00€
373900.100 100 µg - -

3 - 19 business days*

773.00€
 
Pore-forming (alpha) subunit of voltage-gated rapidly inactivating A-type potassium channels. May... more
Product information "KCND1, Recombinant, Human, aa410-647, His-Tag (Potassium Voltage-gated Channel Subfamily D Member 1"
Pore-forming (alpha) subunit of voltage-gated rapidly inactivating A-type potassium channels. May contribute to I(To) current in heart and I(Sa) current in neurons. Channel properties are modulated by interactions with other alpha subunits and with regulatory subunits. Source: Recombinant protein corresponding to aa410-647 from human KCND1, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~29.7kD, AA Sequence: NFSRIYHQNQRADKRRAQQKVRLARIRLAKSGTTNAFLQYKQNGGLEDSGSGEEQALCVRNRSAFEQQHHHLLHCLEKTTCHEFTDELTFSEALGAVSPGGRTSRSTSVSSQPVGPGSLLSSCCPRRAKRRAIRLANSTASVSRGSMQELDMLAGLRRSHAPQSRSSLNAKPHDSLDLNCDSRDFVAAIISIPTPPANTPDESQPSSPGGGGRAGSTLRNSSLGTPCLFPETVKISSL, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Keywords: KCND1, Voltage-gated potassium channel subunit Kv4.1, Potassium voltage-gated channel subfamily D member 1
Supplier: United States Biological
Supplier-Nr: 373900

Properties

Conjugate: No
MW: 29,7
Format: Highly Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "KCND1, Recombinant, Human, aa410-647, His-Tag (Potassium Voltage-gated Channel Subfamily D Member 1"
Write a review
or to review a product.
Viewed