Kallikrein-14, Recombinant, Mouse, aa24-250, His-SUMO-tag (Klk14)

Kallikrein-14, Recombinant, Mouse, aa24-250, His-SUMO-tag (Klk14)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
405970.20 20 µg - -

3 - 19 business days*

575.00€
405970.100 100 µg - -

3 - 19 business days*

855.00€
 
Serine-type endopeptidase with a dual trypsin-like and chymotrypsin-like substrate specificity.... more
Product information "Kallikrein-14, Recombinant, Mouse, aa24-250, His-SUMO-tag (Klk14)"
Serine-type endopeptidase with a dual trypsin-like and chymotrypsin-like substrate specificity. May activate/inactivate the proteinase-activated receptors F2R, F2RL1 and F2RL3 and other kallikreins including KLK1, KLK3, KLK5 and KLK11. May function in seminal clot liquefaction through direct cleavage of the semenogelin SEMG1 and SEMG2 and activation of KLK3. May function through desmoglein DSG1 cleavage in epidermal desquamation a process by which the most superficial corneocytes are shed from the skin surface. May be involved in several aspects of tumor progression including growth, invasion and angiogenesis. Source: Recombinant protein corresponding to aa24-250 from mouse Kallikrein-14, fused to His-SUMO-tag at N-terminal, expressed in E. coli. Molecular Weight: ~40.5kD, AA Sequence: IIGGYRCVRNSQPWQVALQAGPGHRFLCGGVLLSDQWVITAAHCARPILHVALGKHNIRRWEATQQVVRVARQVPHPQYQPQAHDNDLMLLKLQKKVRLGRAVKTISVASSCASPGTPCRVSGWGTIASPIARYPTALQCVNVNIMSEQACHRAYPGIITSGMVCAGVPEGGKDSCQGDSGGPLVCGGQLQGLVSWGMERCAMPGYPGVYANLCNYHSWIQRTMQSN, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Keywords: Gk14, mGK14, Klk14, EC=3.4.21.-, Kallikrein-14, Glandular kallikrein KLK14, Kallikrein related-peptidase 14
Supplier: United States Biological
Supplier-Nr: 405970

Properties

Conjugate: No
MW: 40,5
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Kallikrein-14, Recombinant, Mouse, aa24-250, His-SUMO-tag (Klk14)"
Write a review
or to review a product.
Viewed