JAM2, Recombinant, Human, aa29-238, His-Tag (Junctional Adhesion Molecule B)

May play a role in the processes of lymphocyte homing to secondary lymphoid organs. Source: Recombinant protein corresponding to aa29-238 from human JAM2, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~25.4kD, AA Sequence: FSAPKDQQVVTAVEYQEAILACKTPKKTVSSRLEWKKLGRSVSFVYYQQTLQGDFKNRAEMIDFNIRIKNVTRSDAGKYRCEVSAPSEQGQNLEEDTVTLEVLVAPAVPSCEVPSSALSGTVVELRCQDKEGNPAPEYTWFKDGIRLLENPRLGSQSTNSSYTMNTKTGTLQFNTVSKLDTGEYSCEARNSVGYRRCPGKRMQVDDLNIS, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.