HSP90a (C-terminal), Recombinant, Human, aa535-732, His-Tag (Heat Shock Protein 90 alpha, HSP90alpha

The protein encoded by this gene is an inducible molecular chaperone that functions as a homodimer. The encoded protein aids in the proper folding of specific target proteins by use of an ATPase activity that is modulated by co-chaperones. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2012]. Source: Recombinant protein corresponding to aa535-732 from human Heat Shock Protein 90 alpha, fused to His-tag and Avi-tag at N-terminal, expressed in E. coli. Molecular Weight: ~25kD, AA Sequence: MHHHHHHGGGLNDIFEAQKIEWHEEFEGKTLVSVTKEGLELPEDEEEKKKQEEKKTK, FENLCKIMKDILEKKVEKVVVSNRLVTSPCCIVTSTYGWTANMERIMKAQALRDNSTM, GYMAAKKHLEINPDHSIIETLRQKAEADKNDKSVKDLVILLYETALLSSGFSLEDPQTH, ANRIYRMIKLGLGIDEDDPTADDTSAAVTEEMPPLEGDDDTSRMEEVD, Applications: Suitable for use in the study of enzyme kinetics, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.