Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
---|---|---|---|---|---|---|---|
H5109-53C.50 | 50 µg | - | - |
3 - 19 business days* |
1,151.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
Recombinant protein corresponding to full length human HDAC8 with a C-terminal His-tag expressed... more
Product information "Histone Deacetylase 8, Recombinant, Human (HDAC8)"
Recombinant protein corresponding to full length human HDAC8 with a C-terminal His-tag expressed in baculovirus in Sf21 insect cells (NM_018486). Specific Activity: ~290pmol/min/ug , Assay Conditions: , 25mM Tris-HCl, pH 8.0, 137mM sodium chloride, 2.7mM KCl, 1mM MgCl2, 0.05% Tween 20 and 20uM HDAC class 2a substrate. Incubation condition: 30 minutes at 37ºC, followed by incubating with developer at RT for 20 minutes. Fluorescence intensity is measured at exc360/em460. Amino Acid Sequence: MEEPEEPADSGQSLVPVYIYSPEYVSMCDSLAKIPKRASMVHSLIEAYALHKQM RIVKPKVASMEEMATFHTDAYLQHLQKVSQEGDDDHPDSIEYGLGYDCPATEG IFDYAAAIGGATITAAQCLIDGMCKVAINWSGGWHHAKKDEASGFCYLNDAVLG ILRLRRKFERILYVDLDLHHGDGVEDAFSFTSKVMTVSLHKFSPGFFPGTGDVS DVGLGKGRYYSVNVPIQDGIQDEKYYQICESVLKEVYQAFNPKAVVLQLGADTI AGDPMCSFNMTPVGIGKCLKYILQWQLATLILGGGGYNLANTARCWTYLTGVIL GKTLSSEIPDHEFFT A YGPDYVLEITPSCRPDRNEPHRIQQILNYIKGNLKHVVH HHHHH, Applications: Useful for the study of enzyme kinetics, screening inhibitors and selectivity profiling. Other applications not tested. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70°C. Aliquots are stable for 6 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Keywords: | HD8, HDAC8, CDA07, EC=3.5.1.98, Histone deacetylase 8 |
Supplier: | United States Biological |
Supplier-Nr: | H5109-53C |
Properties
Conjugate: | No |
Format: | Purified |
Database Information
KEGG ID : | K11405 | Matching products |
UniProt ID : | Q9BY41 | Matching products |
Gene ID | GeneID 55869 | Matching products |
Handling & Safety
Storage: | -80°C |
Shipping: | -20°C (International: -20°C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed