Histone Deacetylase 8, Recombinant, Human (HDAC8)

Recombinant protein corresponding to full length human HDAC8 with a C-terminal His-tag expressed in baculovirus in Sf21 insect cells (NM_018486). Specific Activity: ~290pmol/min/ug , Assay Conditions: , 25mM Tris-HCl, pH 8.0, 137mM sodium chloride, 2.7mM KCl, 1mM MgCl2, 0.05% Tween 20 and 20uM HDAC class 2a substrate. Incubation condition: 30 minutes at 37ºC, followed by incubating with developer at RT for 20 minutes. Fluorescence intensity is measured at exc360/em460. Amino Acid Sequence: MEEPEEPADSGQSLVPVYIYSPEYVSMCDSLAKIPKRASMVHSLIEAYALHKQM RIVKPKVASMEEMATFHTDAYLQHLQKVSQEGDDDHPDSIEYGLGYDCPATEG IFDYAAAIGGATITAAQCLIDGMCKVAINWSGGWHHAKKDEASGFCYLNDAVLG ILRLRRKFERILYVDLDLHHGDGVEDAFSFTSKVMTVSLHKFSPGFFPGTGDVS DVGLGKGRYYSVNVPIQDGIQDEKYYQICESVLKEVYQAFNPKAVVLQLGADTI AGDPMCSFNMTPVGIGKCLKYILQWQLATLILGGGGYNLANTARCWTYLTGVIL GKTLSSEIPDHEFFT A YGPDYVLEITPSCRPDRNEPHRIQQILNYIKGNLKHVVH HHHHH, Applications: Useful for the study of enzyme kinetics, screening inhibitors and selectivity profiling. Other applications not tested. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70°C. Aliquots are stable for 6 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.