GPC6, Recombinant, Human, aa24-529, His-Tag (Glypican-6)

GPC6, Recombinant, Human, aa24-529, His-Tag (Glypican-6)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
373510.20 20 µg - -

3 - 19 business days*

531.00€
373510.100 100 µg - -

3 - 19 business days*

773.00€
 
Cell surface proteoglycan that bears heparan sulfate. Putative cell surface coreceptor for growth... more
Product information "GPC6, Recombinant, Human, aa24-529, His-Tag (Glypican-6)"
Cell surface proteoglycan that bears heparan sulfate. Putative cell surface coreceptor for growth factors, Extracellular domain matrix proteins, proteases and anti-proteases. Enhances migration and invasion of cancer cells through WNT5A signaling. Source: Recombinant protein corresponding to aa24-529 from human Glypican-6, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~59.5kD, AA Sequence: DVKARSCGEVRQAYGAKGFSLADIPYQEIAGEHLRICPQEYTCCTTEMEDKLSQQSKLEFENLVEETSHFVRTTFVSRHKKFDEFFRELLENAEKSLNDMFVRTYGMLYMQNSEVFQDLFTELKRYYTGGNVNLEEMLNDFWARLLERMFQLINPQYHFSEDYLECVSKYTDQLKPFGDVPRKLKIQVTRAFIAARTFVQGLTVGREVANRVSKVSPTPGCIRALMKMLYCPYCRGLPTVRPCNNYCLNVMKGCLANQADLDTEWNLFIDAMLLVAERLEGPFNIESVMDPIDVKISEAIMNMQENSMQVSAKVFQGCGQPKPAPALRSARSAPENFNTRFRPYNPEERPTTAAGTSLDRLVTDIKEKLKLSKKVWSALPYTICKDESVTAGTSNEEECWNGHSKARYLPEIMNDGLTNQINNPEVDVDITRPDTFIRQQIMALRVMTNKLKNAYNGNDVNFQDTSDESSGSGSGSGCMDDVCPTEFEFVTTEAPAVDPDRREVDS, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Keywords: GPC6
Supplier: United States Biological
Supplier-Nr: 373510

Properties

Conjugate: No
MW: 59,5
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "GPC6, Recombinant, Human, aa24-529, His-Tag (Glypican-6)"
Write a review
or to review a product.
Viewed