Gamma-Crystallin B, Recombinant, Rat, aa2-175, His-Tag (Crygb)

Crystallins are the dominant structural components of the vertebra. Source: Recombinant protein corresponding to aa2-175 of rat Gamma-Crystallin B, fused to 6xHis-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~23kD, AA Sequence: GKITFFEDRGFQGRCYECSSDCPNLQTYFSRCNSVRVDSGCWMLYERPNYQGHQYFLRRGDYPDYQQWMGFSDSIRSCRLIPQHSGTYRMRIYERDDFRGQMSEITDDCLSLQDRFHLSEIHSLNVMEGCWVLYEMPSYRGRQYLLRPGEYRRYLDWGAANAKVGSFRRVMDFY, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.