Fruit Protein pKIWI502, Recombinant, Actinidia Deliciosa, aa1-317, His-SUMO-Tag (pKIWI502)

Fruit Protein pKIWI502, Recombinant, Actinidia Deliciosa, aa1-317, His-SUMO-Tag (pKIWI502)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
373367.20 20 µg - -

3 - 19 business days*

636.00€
373367.100 100 µg - -

3 - 19 business days*

985.00€
 
Source:|Recombinant protein corresponding to aa1-317 from actinidia deliciosa pKIWI502, fused to... more
Product information "Fruit Protein pKIWI502, Recombinant, Actinidia Deliciosa, aa1-317, His-SUMO-Tag (pKIWI502)"
Source:, Recombinant protein corresponding to aa1-317 from actinidia deliciosa pKIWI502, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~51.2kD, AA Sequence: MSITLSRPSLSRPSLSRHPSLTLHSSLSHAPPHHRPVAFLRHPTLRYHHHGRLLSVASAILQDTAIRQDTYIWTPVPISRVLPAAAESLFKVIVDLSRSPDLVYNFVSPGQYVQIRIPEAIVNPPPRPAYFYIASPPSLVKKNLEFEFLIRSVPGTTSEVLCSLKEGDVVDLTQIIGRGFDIEQILPPEDYPTVLISVTGYGMSAGRSFIEEGFGANKRSDVRLYYGAENLETMGYQERFKDWEASGVRVIPVLSRPPPNWNGAVGYVQDVYLKDKPIADPRTTGAVLIGNPNMVEETRGILVAQGVSREKILVTQD, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Keywords: pKIWI502, Fruit protein pKIWI502
Supplier: United States Biological
Supplier-Nr: 373367

Properties

Conjugate: No
MW: 51,2
Format: Highly Purified

Database Information

UniProt ID : P43394 | Matching products

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Fruit Protein pKIWI502, Recombinant, Actinidia Deliciosa, aa1-317, His-SUMO-Tag (pKIWI502)"
Write a review
or to review a product.
Viewed