FKBP3, Recombinant, Human, aa2-224, His-SUMO-Tag (Peptidyl-prolyl Cis-trans Isomerase FKBP3)

FK506- and rapamycin-binding proteins (FKBPs) constitute a family of receptors for the two immunosuppressants which inhibit T-cell proliferation by arresting two distinct Cytoplasmic domain signal transmission pathways. PPIases accelerate the folding of proteins. Source: Recombinant protein corresponding to aa2-224 from human FKBP3, fused to His-SUMO-Tagat N-terminal, expressed in E. coli. Molecular Weight: ~41kD, AA Sequence: AAAVPQRAWTVEQLRSEQLPKKDIIKFLQEHGSDSFLAEHKLLGNIKNVAKTANKDHLVTAYNHLFETKRFKGTESISKVSEQVKNVKLNEDKPKETKSEETLDEGPPKYTKSVLKKGDKTNFPKKGDVVHCWYTGTLQDGTVFDTNIQTSAKKKKNAKPLSFKVGVGKVIRGWDEALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDID, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.