FKBP-Type Peptidyl-Prolyl Cis-Trans Isomerase FkpA, Recombinant, Aeromonas Hydrophila, aa21-268, His

PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. FkpA probably acts in the folding of extra cytoplasmic domain proteins. Source: Recombinant protein corresponding to aa21-268 of Aeromonas Hydrophila FKBP-Type Peptidyl-Prolyl Cis-Trans Isomerase FkpA, fused to 6xHis-Sumo-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~42.7kD, AA Sequence: CQKDEKTAANTAEVKAEASKPAEAPKAEAKSFEEQSGYAIGLSMGRYIANTLERQQELGIKLDNSVILKGVTDGLGKEAKMTDEEIQKVLQQYDAKINELTKAKADKDAVENQKKGEEYLAANAKKEGVKSTESGLQYQVEKMGTGAKPKATDIVKVHYTGTLTDGTKFDSSVDRGEPATFPLNQVIPGWTEGVQLMPVGSKFKFFLPSKLAYGEHGAGSIPANAVLVFDVELLAIEKPAADGDNAKK, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.