FCER1G, Recombinant, Human, aa19-86, GST-Tag (High Affinity Immunoglobulin Epsilon Receptor Subunit

Associates with a variety of FcR alpha chains to form a functional signaling complex. Regulates several aspects of the immune response. The gamma subunit has a critical role in allowing the IgE Fc receptor to reach the cell surface. Also involved in collagen-mediated platelet activation and in neutrophil activation mediated by integrin. Source: Recombinant protein corresponding to aa19-86 from human FCER1G, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~34.8kD, AA Sequence: LGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.