FbpA, Recombinant, Mycobacterium Tuberculosis, aa53-331, His-Tag (Antigen 85-A)

FbpA, Recombinant, Mycobacterium Tuberculosis, aa53-331, His-Tag (Antigen 85-A)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
373284.20 20 µg - -

3 - 19 business days*

636.00€
373284.200 200 µg - -

3 - 19 business days*

985.00€
 
The antigen 85 proteins (FbpA, FbpB, FbpC) are responsible for the high affinity of mycobacteria... more
Product information "FbpA, Recombinant, Mycobacterium Tuberculosis, aa53-331, His-Tag (Antigen 85-A)"
The antigen 85 proteins (FbpA, FbpB, FbpC) are responsible for the high affinity of mycobacteria for fibronectin, a large adhesive glycoprotein, which facilitates the attachment of M.tuberculosis to murine alveolar macrophages (AMs). They also help to maintain the integrity of the cell wall by catalyzing the transfer of mycolic acids to cell wall arabinogalactan, and through the synthesis of alpha,alpha-trehalose dimycolate (TDM, cord factor). They catalyze the transfer of a mycoloyl residue from one molecule of alpha,alpha-trehalose monomycolate (TMM) to another TMM, leading to the formation of TDM. FbpA mediates triacylglycerol (TAG) formation with long-chain acyl-CoA as the acyl donor and 1,2-dipalmitoyl-sn-glycerol (1,2-dipalmitin) as the acyl acceptor (By similarity). Source: Recombinant protein corresponding to aa53-331 from Mycobacterium tuberculosis Antigen 85-A, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~34.2kD, AA Sequence: YLQVPSPSMGRDIKVQFQSGGANSPALYLLDGLRAQDDFSGWDINTPAFEWYDQSGLSVVMPVGGQSSFYSDWYQPACGKAGCQTYKWETFLTSELPGWLQANRHVKPTGSAVVGLSMAASSALTLAIYHPQQFVYAGAMSGLLDPSQAMGPTLIGLAMGDAGGYKASDMWGPKEDPAWQRNDPLLNVGKLIANNTRVWVYCGNGKPSDLGGNNLPAKFLEGFVRTSNIKFQDAYNAGGGHNGVFDFPDSGTHSWEYWGAQLNAMKPDLQRALGATPNT, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Keywords: 85A, fbpA, DGAT, Ag85A, mpt44, Fbps A, MT3911, EC=2.3.1.20, EC=2.3.1.122, Antigen 85 complex A, Fibronectin-binding protein A, Acyl-CoA:diacylglycerol acyltransferase, Diacylglycerol acyltransferase/mycolyltransferase Ag85A
Supplier: United States Biological
Supplier-Nr: 373284

Properties

Conjugate: No
MW: 34,2
Format: Purified

Database Information

KEGG ID : K18851 | Matching products
UniProt ID : P9WQP2 | Matching products

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "FbpA, Recombinant, Mycobacterium Tuberculosis, aa53-331, His-Tag (Antigen 85-A)"
Write a review
or to review a product.
Viewed