Clumping Factor A, Recombinant, Staphylococcus Aureus, aa229-559, His-SUMO-Tag (ClfA)

Clumping Factor A, Recombinant, Staphylococcus Aureus, aa229-559, His-SUMO-Tag (ClfA)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
370567.20 20 µg - -

3 - 19 business days*

636.00€
370567.100 100 µg - -

3 - 19 business days*

985.00€
 
Cell surface-associated protein implicated in virulence. Promotes bacterial attachment... more
Product information "Clumping Factor A, Recombinant, Staphylococcus Aureus, aa229-559, His-SUMO-Tag (ClfA)"
Cell surface-associated protein implicated in virulence. Promotes bacterial attachment exclusively to the gamma-chain of human fibrinogen. Induces formation of bacterial clumps (By similarity). Source: Recombinant protein corresponding to aa229-559 from Staphylococcus aureus clfA, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~52.41kD, AA Sequence: GTDITNQLTNVTVGIDSGTTVYPHQAGYVKLNYGFSVPNSAVKGDTFKITVPKELNLNGVTSTAKVPPIMAGDQVLANGVIDSDGNVIYTFTDYVNTKDDVKATLTMPAYIDPENVKKTGNVTLATGIGSTTANKTVLVDYEKYGKFYNLSIKGTIDQIDKTNNTYRQTIYVNPSGDNVIAPVLTGNLKPNTDSNALIDQQNTSIKVYKVDNAADLSESYFVNPENFEDVTNSVNITFPNPNQYKVEFNTPDDQITTPYIVVVNGHIDPNSKGDLALRSTLYGYNSNIIWRSMSWDNEVAFNNGSGSGDGIDKPVVPEQPDEPGEIEPIPE, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Keywords: clfA, SACOL0856, Clumping factor A, Fibrinogen receptor A, Fibrinogen-binding protein A
Supplier: United States Biological
Supplier-Nr: 370567

Properties

Conjugate: No
MW: 52,41
Format: Purified

Database Information

KEGG ID : K14201 | Matching products
UniProt ID : Q5HHM8 | Matching products

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Clumping Factor A, Recombinant, Staphylococcus Aureus, aa229-559, His-SUMO-Tag (ClfA)"
Write a review
or to review a product.
Viewed