CD70, Recombinant, Human, aa39-193, His-Tag (CD70 Antigen, Tumor Necrosis Factor Ligand Superfamily

The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for TNFRSF27/CD27. It is a surface antigen on activated, but not on resting, T and B lymphocytes. It induces proliferation of costimulated T cells, enhances the generation of cytolytic T cells, and contributes to T cell activation. This cytokine is also reported to play a role in regulating B-cell activation, cytotoxic function of natural killer cells, and immunoglobulin sythesis. [provided by RefSeq, Jul 2008]. Source: Recombinant protein corresponding to aa39-193 from human CD70, fused to His-tag at N-terminal, expressed in a HEK293 cell expression system. Molecular Weight: ~19.7kD, runs at a higher MW by SDS-PAGE due to glycosylation, Endotoxin: <1EU/ug, AA Sequence: HHHHHHHHHHGGGSGGGSGGGSIEGRQRFAQAQQQLPLESLGWDVAELQLNHTGP, QQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHP, TTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETF, FGVQWVRP, Applications: Suitable for use in the study of protein binding and for screening small molecules and antibodies. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70°C. Aliquots are stable for 6 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.