CD274, Mouse IgG2a Fc Fusion Protein (CD274 Molecule, B7 Homolog 1, B7H1, B7-H1, B7-H, Programmed Ce

Molecular Structure: , A soluble fusion protein consisting of the murine CD8 alpha leader sequence, the mature extracellular (224aa) domain of human CD274 fused to murine IgG2a Fc + hinge (233aa). muCD8 apha signal peptide residual amino acids+ linker: (1) kpqapelrgsas , CD274 mature EC: (224aa): (13)ftvtvpkdlyvveygsnmtieckfpvekqldlaalivywemedkniiqfvhgeedlkvqhssyrqrarllkdqlslgnaalqitdvklqdagvyrcmisyggadykritvkvnapynkinqrilvvdpvtseheltcqaegypkaeviwtssdhqvlsgkttttnskreeklfnvtstlrintttneifyctfrrldpeenhtaelvipelplahppnerthtr, Linker +Murine IgG2a Hinge + Fc (235 aa): (237)gteprgptikpcppckcpapnllggpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnvevhtaqtqthredynstlrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskpkgsvrapqvyvlpppeeemtkkqvtltcmvtdfmpediyvewtnngktelnykntepvldsdgsyfmysklrvekknwvernsyscsvvheglhnhhttksfsrtpg(471) , Predicted monomeric (non glycosylated) molecular weight: 54.4 kd. The molecule is dimeric and runs at about 120 kd in SDS-PAGE under native conditions. CD274 (B7-H1, PD-L1, Programmed Death Ligand) is a member of the B7 family and is expressed on a variety of tissues including lymphoid cells.  It plays an important role in regulation of T cell activation, and is involved in progression of cancer, arthritis and HIV infection.  CD274 binding to its receptor CD279 (PD-1) on activated T cells can decrease proliferation.  Conversely, ligation of CD279 on primed T cells can stimulate IL-10 production.  High levels of CD274 present in Renal cell carcinoma are associated with poor prognosis.  Tumor expressed CD274 can increase apoptosis of tumor specific T cells resulting in better tumor cell survival.  Gamma Interferon and PHA can up regulate CD274 expression on T cells. , Applications: , Suitable for use in ELISA. Other applications have not been tested. , Recommended Dilutions: Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months at -20°C after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.