Carboxylesterase 1C, Recombinant, Mouse, aa19-550, His-Tag (Ces1c)

Carboxylesterase 1C, Recombinant, Mouse, aa19-550, His-Tag (Ces1c)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
370551.20 20 µg - -

3 - 19 business days*

621.00€
370551.100 100 µg - -

3 - 19 business days*

947.00€
 
Involved in the detoxification of xenobiotics and in the activation of ester and amide prodrugs.... more
Product information "Carboxylesterase 1C, Recombinant, Mouse, aa19-550, His-Tag (Ces1c)"
Involved in the detoxification of xenobiotics and in the activation of ester and amide prodrugs. Involved in the Extracellular domain metabolism of lung surfactant. Source: Recombinant protein corresponding to aa19-550 from mouse Ces1c, fused to His-Tag at N-terminal, expressed in yeast. Molecular Weight: ~60.6kD, AA Sequence: HSLLPPVVDTTQGKVLGKYISLEGFEQPVAVFLGVPFAKPPLGSLRFAPPQPAEPWSFVKNATSYPPMCSQDAGWAKILSDMFSTEKEILPLKISEDCLYLNIYSPADLTKSSQLPVMVWIHGGGLVIGGASPYNGLALSAHENVVVVTIQYRLGIWGLFSTGDEHSPGNWAHLDQLAALRWVQDNIANFGGNPDSVTIFGESSGGISVSVLVLSPLGKDLFHRAISESGVVINTNVGKKNIQAVNEIIATLSQCNDTSSAAMVQCLRQKTESELLEISGKLVQYNISLSTMIDGVVLPKAPEEILAEKSFNTVPYIVGFNKQEFGWIIPMMLQNLLPEGKMNEETASLLLRRFHSELNISESMIPAVIEQYLRGVDDPAKKSELILDMFGDIFFGIPAVLLSRSLRDAGVSTYMYEFRYRPSFVSDKRPQTVEGDHGDEIFFVFGAPLLKEGASEEETNLSKMVMKFWANFARNGNPNGEGLPHWPEYDEQEGYLQIGATTQQAQRLKAEEVAFWTELLAKNPPETDPTEH, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Keywords: Es1, Ces1c, PES-N, EC=3.1.1.1, Carboxylesterase 1C, Liver carboxylesterase N, Lung surfactant convertase
Supplier: United States Biological
Supplier-Nr: 370551

Properties

Conjugate: No
MW: 60,6
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Carboxylesterase 1C, Recombinant, Mouse, aa19-550, His-Tag (Ces1c)"
Write a review
or to review a product.
Viewed