BTN3A2, Recombinant, Human, aa30-248, His-Tag (Butyrophilin Subfamily 3 Member A2)

Plays a role in T-cell responses in the adaptive immune response. Inhibits the release of IFNG from activated T-cells. Source: Recombinant protein corresponding to aa30-248 from human BTN3A2, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~25.6kD, AA Sequence: QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSNLHVEVKGYEDGGIHLECRSTGWYPQPQIQWSNAKGENIPAVEAPVVADGVGLYEVAASVIMRGGSGEGVSCIIRNSLLGLEKTASISIADPFFRSAQPW, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.