ALTA1, Recombinant, Alternaria Alternata, aa19-157, His-Tag (Major Allergen Alt a 1)

ALTA1, Recombinant, Alternaria Alternata, aa19-157, His-Tag (Major Allergen Alt a 1)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
372237.20 20 µg - -

3 - 19 business days*

675.00€
372237.100 100 µg - -

3 - 19 business days*

1,045.00€
 
Source:|Recombinant protein corresponding to aa19-157 from alternaria alternata ALTA1, fused to... more
Product information "ALTA1, Recombinant, Alternaria Alternata, aa19-157, His-Tag (Major Allergen Alt a 1)"
Source:, Recombinant protein corresponding to aa19-157 from alternaria alternata ALTA1, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~17.2kD, AA Sequence: APLESRQDTASCPVTTEGDYVWKISEFYGRKPEGTYYNSLGFNIKATNGGTLDFTCSAQADKLEDHKWYSCGENSFMDFSFDSDRSGLLLKQKVSDDITYVATATLPNYCRAGGNGPKDFVCQGVADAYITLVTLPKSS, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Keywords: ALTA1, Alt a 1, Major allergen Alt a 1
Supplier: United States Biological
Supplier-Nr: 372237

Properties

Conjugate: No
MW: 17,2
Format: Highly Purified

Database Information

UniProt ID : P79085 | Matching products
Gene ID GeneID 29120368 | Matching products

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "ALTA1, Recombinant, Alternaria Alternata, aa19-157, His-Tag (Major Allergen Alt a 1)"
Write a review
or to review a product.
Viewed