Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
---|---|---|---|---|---|---|---|
517797.20 | 20 µg | - | - |
3 - 19 business days* |
636.00€
|
||
517797.100 | 100 µg | - | - |
3 - 19 business days* |
985.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
Monomer: binds with high affinity to muscular (alpha-1-beta-1-gamma-delta... more
Product information "Alpha-Cobratoxin, Recombinant, Naja Kaouthia, aa1-71, His-GST-Tag, Myc-Tag"
Monomer: binds with high affinity to muscular (alpha-1-beta-1-gamma-delta (CHRNA1/CHRNB1/CHRNG/CHRND) nAChR) (IC50=4.5nM on Torpedo californica membranes) and neuronal alpha-7/CHRNA7 nicotinic acetylcholine receptors (IC50=105nM)., Homodimer: binds with high affinity (but lower than the monomeric form) to muscular (IC50=9.7nM) and with low affinity to neuronal alpha-7/CHRNA7 nAChRs (IC50=1370nM). However, it acquires (compared to the monomeric form) the capacity to block alpha-3/beta-2 (CHRNA3/CHRNB2) nAChRs Heterodimer with cytotoxin 3 (AC P01446): is slightly more active than the homodimer in inhibiting alpha-7 nAChR and is considerably more active in blocking the alpha-3-beta-2 nAChR. The monomeric form has no effect on alpha-3/beta-2 (CHRNA3/CHRNB2) nAChR. It does not show any blockade of the nicotine-evoked release of dopamine and does not affect ACh release. Source: Recombinant protein corresponding to aa1-71 of Naja Kaouthia Alpha-Cobratoxin, fused to 10xHis-GST-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E. coli. Molecular Weight: ~37.8kD, AA Sequence: IRCFITPDITSKDCPNGHVCYTKTWCDAFCSIRGKRVDLGCAATCPTVKTGVDIQCCSTDNCNPFPTRKRP, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Keywords: | alpha-CT, Alpha-CbT, alpha-Cbtx, Siamensis 3, Alpha-EPTX-Nk2a, Alpha-cobratoxin, Long neurotoxin 1, Alpha-elapitoxin-Nk2a |
Supplier: | United States Biological |
Supplier-Nr: | 517797 |
Properties
Conjugate: | No |
Host: | E.coli |
Species reactivity: | Naja kaouthia |
MW: | 37.8 kD |
Purity: | ?85% (SDS-PAGE) |
Database Information
UniProt ID : | P01391 | Matching products |
Handling & Safety
Storage: | -20°C |
Shipping: | +4°C (International: °C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed