Alpha-Cobratoxin, Recombinant, Naja Kaouthia, aa1-71, His-GST-Tag, Myc-Tag

Alpha-Cobratoxin, Recombinant, Naja Kaouthia, aa1-71, His-GST-Tag, Myc-Tag
Item number Size Datasheet Manual SDS Delivery time Quantity Price
517797.20 20 µg - -

3 - 19 business days*

636.00€
517797.100 100 µg - -

3 - 19 business days*

985.00€
 
Monomer: binds with high affinity to muscular (alpha-1-beta-1-gamma-delta... more
Product information "Alpha-Cobratoxin, Recombinant, Naja Kaouthia, aa1-71, His-GST-Tag, Myc-Tag"
Monomer: binds with high affinity to muscular (alpha-1-beta-1-gamma-delta (CHRNA1/CHRNB1/CHRNG/CHRND) nAChR) (IC50=4.5nM on Torpedo californica membranes) and neuronal alpha-7/CHRNA7 nicotinic acetylcholine receptors (IC50=105nM)., Homodimer: binds with high affinity (but lower than the monomeric form) to muscular (IC50=9.7nM) and with low affinity to neuronal alpha-7/CHRNA7 nAChRs (IC50=1370nM). However, it acquires (compared to the monomeric form) the capacity to block alpha-3/beta-2 (CHRNA3/CHRNB2) nAChRs Heterodimer with cytotoxin 3 (AC P01446): is slightly more active than the homodimer in inhibiting alpha-7 nAChR and is considerably more active in blocking the alpha-3-beta-2 nAChR. The monomeric form has no effect on alpha-3/beta-2 (CHRNA3/CHRNB2) nAChR. It does not show any blockade of the nicotine-evoked release of dopamine and does not affect ACh release. Source: Recombinant protein corresponding to aa1-71 of Naja Kaouthia Alpha-Cobratoxin, fused to 10xHis-GST-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E. coli. Molecular Weight: ~37.8kD, AA Sequence: IRCFITPDITSKDCPNGHVCYTKTWCDAFCSIRGKRVDLGCAATCPTVKTGVDIQCCSTDNCNPFPTRKRP, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Keywords: alpha-CT, Alpha-CbT, alpha-Cbtx, Siamensis 3, Alpha-EPTX-Nk2a, Alpha-cobratoxin, Long neurotoxin 1, Alpha-elapitoxin-Nk2a
Supplier: United States Biological
Supplier-Nr: 517797

Properties

Conjugate: No
Host: E.coli
Species reactivity: Naja kaouthia
MW: 37.8 kD
Purity: ?85% (SDS-PAGE)

Database Information

UniProt ID : P01391 | Matching products

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Alpha-Cobratoxin, Recombinant, Naja Kaouthia, aa1-71, His-GST-Tag, Myc-Tag"
Write a review
or to review a product.
Viewed