ALDH1A2, Recombinant, Human, aa1-518, His-Tag (Retinal Dehydrogenase 2)

ALDH1A2, Recombinant, Human, aa1-518, His-Tag (Retinal Dehydrogenase 2)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
370508.20 20 µg - -

3 - 19 business days*

621.00€
370508.100 100 µg - -

3 - 19 business days*

947.00€
 
Recognizes as substrates free retinal and cellular retinol-binding protein-bound retinal. Does... more
Product information "ALDH1A2, Recombinant, Human, aa1-518, His-Tag (Retinal Dehydrogenase 2)"
Recognizes as substrates free retinal and cellular retinol-binding protein-bound retinal. Does metabolize octanal and decanal but does not metabolize citral, benzaldehyde, acetaldehyde and propanal efficiently, Source: Recombinant protein corresponding to aa1-518 from human ALDH1A2, fused to His-Tag at N-terminal, expressed in Yeast, Molecular Weight: ~58.72kD, AA Sequence: MTSSKIEMPGEVKADPAALMASLHLLPSPTPNLEIKYTKIFINNEWQNSESGRVFPVYNPATGEQVCEVQEADKADIDKAVQAARLAFSLGSVWRRMDASERGRLLDKLADLVERDRAVLATMESLNGGKPFLQAFYVDLQGVIKTFRYYAGWADKIHGMTIPVDGDYFTFTRHEPIGVCGQIIPWNFPLLMFAWKIAPALCCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVINILPGYGPTAGAAIASHIGIDKIAFTGSTEVGKLIQEAAGRSNLKRVTLELGGKSPNIIFADADLDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVRRSVERAKRRVVGSPFDPTTEQGPQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALTVSSAMQAGTVWINCYNALNAQSPFGGFKMSGNGREMGEFGLREYSEVKTVTVKIPQKNS, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Keywords: RALDH2, RalDH2, RALDH 2, ALDH1A2, RALDH(II), EC=1.2.1.36, Retinal dehydrogenase 2, Aldehyde dehydrogenase family 1 member A2, Retinaldehyde-specific dehydrogenase type 2
Supplier: United States Biological
Supplier-Nr: 370508

Properties

Conjugate: No
MW: 58,72
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "ALDH1A2, Recombinant, Human, aa1-518, His-Tag (Retinal Dehydrogenase 2)"
Write a review
or to review a product.
Viewed